GenomeNet

>smr:Smar_1389 glycoside hydrolase family protein (EC:3.2.1.1); K07405 alpha-amylase [EC:3.2.1.1] (A)
MSDIVFMFEVHQPYRLDRNAYNKLLEKALRGRLEPHDLEDAIFDNGLNKLVIERASTKCY
IPATKIILENIKRYANSNKPFKVAYSISGVFIEQVRMWKPEVIDLFMELRETGMVEFVEQ
TYYHSMAAFMPLKDWSELREQILEHRRAMKELFDYEPKSIENTEFSYNNDIAWLFSSMGY
KVVLTEGVDWVLGWRSPNYVYRAYGSDIKVLTRNYRLSDDIGYRFSDRNWDQYPLTADKY
ASWLAATPGDVIFLAMDYETFGEHHWPETGIHEFLRWLPGEILKYNHLYTSTPSEVVDKY
PARDIIDVPPWNTISWADERDLSAWLGNHMQRNAFKILVDLRPYVKALDEPEITRIWKLL
TISDHLYYIATKFGSIEQVHSYFSPYKNAPDAYAIYVQALSLLAGLIAEKIEQKKYDVAR
KLVLPMNKAFYFYKPTGEYTGYSATNIKEFLEIISKAPAESILYHLKRGDFQAWLRSIFG
LDEIADELDKISSQPLSAEEARKAVSDIIRKFLSST

BLAST