GenomeNet

>smu:SMU_506 K01155 type II restriction enzyme [EC:3.1.21.4] | (RefSeq) type II restriction endonuclease (A)
MVNTVDDNLKYSVFDYLNLSSEAKLEFFMETRSSLSFLASYWFDFDNVKANISNYDEPDL
YTLDYLIGKSDQEIDNFFKKRPNLLLLVPKLLGIRDSKFEKPIRNRILKVQDVSGVYTLN
FKDIDLSKLDLYLQFIHDSGLDWVFKIGLRKSVHDYVVGVEAGMDSNGRKNRSGDMGELY
LETALKKIAKEKAWLAHGQSTRSSIKNWYGIDLDKSFENRRFDGSLFNPVRKKLYLFEVN
NFNSSGSKSKASATEFKDLHDRFSRTNHEFIYITDGKGWDSDKSHLMEAMKYIGKVFNYK
MIESDYLNDYLE

BLAST