GenomeNet

>smut:SMUGS5_04800 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSSLDTRDGFGVVASRIGMRREAV
TITDDMDIFAYIENMFEKPYCILIDESQFLSQKNVYDLARIVDELDVPVMAFGLKNDFQN
HLFEGSRELLLLADKIEEIKTICQFCSKKATMVLRTENGRPVYMGNQIQIGGNETYIPVC
RRHYFHPPIKA

BLAST