GenomeNet

>smx:SM11_chr0444 gst11; putative glutathione S-transferase protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MPSTLTNATGAPYVGAADTLSISHLEASVMADLSSFPITARWPAKNPDIIQLYSLPTPNG
VKVSIALEELGLAYEAHRISFDTNEQKSPEFLSLNPNGRIPAIIDPNGPDGKPIGLFESG
AILIYLAEKTGKLLPADAARRYETLCWVMFQMGGIGPMFGQFGHFFKFAADKVANNPYPV
QRYRDEAKRLLGVLEARLEGRQWLMGEEYTIADIATYPWVEGARKFYGGAEVLDYKSFPN
VMDWVDRGLARPAAQKGMEIPRKE

BLAST