GenomeNet

>smx:SM11_chr0444 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) gst11; putative glutathione S-transferase protein (A)
MPSTLTNATGAPYVGAADTLSISHLEASVMADLSSFPITARWPAKNPDIIQLYSLPTPNG
VKVSIALEELGLAYEAHRISFDTNEQKSPEFLSLNPNGRIPAIIDPNGPDGKPIGLFESG
AILIYLAEKTGKLLPADAARRYETLCWVMFQMGGIGPMFGQFGHFFKFAADKVANNPYPV
QRYRDEAKRLLGVLEARLEGRQWLMGEEYTIADIATYPWVEGARKFYGGAEVLDYKSFPN
VMDWVDRGLARPAAQKGMEIPRKE

BLAST