GenomeNet

>smx:SM11_chr0762 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (GenBank) sodC; putative superoxide dismutase Cu-Zn precursor (bacteriocuprein) transmembrane protein (A)
MMRTMIAIACAAGMAGAASAQQSSQTATAEFVGKDGTDIGRATLTAGGKGVLIEMEISGL
PKDTWVAFHAHEMGRCDPKDGFESAGKHFAGEDENAEHGFLASNGPHAGDMPNQYVGADG
TLRAQVFNSFVSLDDRATALRGRALVIHVHSDDNRSQPSGDAGDRLACAVVK

BLAST