GenomeNet

>smx:SM11_chr0762 sodC; putative superoxide dismutase Cu-Zn precursor (bacteriocuprein) transmembrane protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MMRTMIAIACAAGMAGAASAQQSSQTATAEFVGKDGTDIGRATLTAGGKGVLIEMEISGL
PKDTWVAFHAHEMGRCDPKDGFESAGKHFAGEDENAEHGFLASNGPHAGDMPNQYVGADG
TLRAQVFNSFVSLDDRATALRGRALVIHVHSDDNRSQPSGDAGDRLACAVVK

BLAST