GenomeNet

>smx:SM11_chr2743 class-III pyridoxal-phosphate-dependent aminotransferase family protein; K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] (A)
MPGLYARESRSVSKMAHLRFFPQAVVGGSGAYLTADDGRQLLDFSASWGAASLGHSHPAI
REAVGRALSDQAGASYLSSANEACVLLAEKLLSLVPERARGRVWFGHSGSDANETVARIV
VAATGRPRILAFHGAYHGGTIGSMGVSGHPAQQGSRAEGLTLVPYPNSYAAGSPRDAALA
HLERLFATEVPPEEVAAFFIEPIQSDGGMLVPPDGFFKAVEALCRRHGILIVSDEVKVGL
GRSGRFNAFEHSGIEPDIVVFGKGLGGGLPISAVVGPEAIMNHSVAFSLQTVHGNPVCAA
AALAVLQTIERDHLILNADRSGKVLREALDRLTARHTLIGDVRGRGLALGIELVTDPASR
EPASRQAALTVYRAFQLGLVLYYVGVQSNVLELTPPLTLTPAEAESGVAMLGQALADVAA
GRIDEALLGDFAGW

BLAST