GenomeNet

>smx:SM11_chr3582 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst9; putative glutathione S-transferase protein (A)
MKLFYSRNPNPRLAVAVARHLAAEVEFEFASPFAPGQAERFRPLNPNLSLPILVEAGKSL
WEADAIACRLSRAMQSDFWRIGDDEPDMVRWISWGKENFVRACDMVQFERGTKQRYGLGP
IDQQLVEEGLSMFRTAAAILDMELSGRNWLVGGAVSHADFRMATFLPFNDAAGLPLGDYP
NICRWIDRLEEIDAWRDPFRGLDAPELPPVPER

BLAST