GenomeNet

>smx:SM11_pD0042 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst15; putative glutathione S-transferase protein (A)
MKLYHHPLSGHAHRARLFLSLLGIEHELVVVDFARREHKQADFLKLNSFGQVPVLDDAGT
IISDSNAILVYLAKKTGRTDWLPEDAAGAAAVQRWLSVAAGQIAHGPAQARLINVFKAPY
RPEEVIPRSHAILALIEQELEGRGWIAADRPTIADVALYSYVARAPEGDVDLQPYPEIRA
WLARTEALPGFVEFEKTPVGLAA

BLAST