GenomeNet

>smx:SM11_pD1129 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glpD; putative glycerol-3-phosphate dehydrogenase protein (A)
MTRTEILDGLRQSPKVDVCVLGGGINGLSVFRELALQGVRVLLVEKHDYCSGASAALSRM
VHGGLRYLENGEFALVKESLVERDRLLRNAPHLVSPLATTVPVFDIFSGLANGIVRFLGL
SRRPSRRGAIAIKAGLSIYDLLTRKRALMPRHRFRGRRATLAKWPALNPKIRSSATYYDA
WVSHPERIGMELLQDGLSASTEAAALNYAELRRNEAGTYIIADDVEGVSVEIEPSLIVNA
TGGWIDITNGALLPPDHRSAPLMGGTKGSHLIIDNVHLRDALGDHMIYYENEDGRICILF
PYFGKVLVGSTDIRVDDPGTVRCEEEERDYILQSLAFVLPGIEIGPEEIVYQFSGVRPLP
ASSDSFTGRIPRDHFCTTIESAGTPVLCMIGGKWTTFRSFGELAADTALERLGLSRRVST
ADRAIGGGRRFPADRESWIAALAARCGLPPPHVAELFSRYGTEAEALAAFIGQGSDAAIP
GAGHTMRELLFLIRNEAVEHLDDLLLRRTTLAISGTLSLAILDAALELLTGEKGWSEARS
LSERNRCLALLRDRHGVDEKALAARMPPPLAKAVAAG

BLAST