GenomeNet

>smx:SM11_pD1220 rbcL; putative ribulose bisphosphate carboxylaseoxygenase, large subunit protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MLRITYRIETPGDVEFLAKKIASDQSTGTFVPVPGETEELKARVAARVLAIRHLEPADRA
SWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPPE
FAAAHPGPQFGVVGSRRLTGVEGRPIIGTIVKPALGLRPEETAVLVGELLSSGVDFIKDD
EKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLVVAAGGN
AAVVNINSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLLGVDQF
QINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGSGQWGGQAPETYARTGHTTDL
LYLCGGGIVSHPGGPGAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLEKFADGKGA

BLAST