GenomeNet

>smx:SM11_pD1412 cbbL; putative ribulose-1,5-bisphosphate carboxylase large subunit protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MNADAKTEIKGRERYKAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQDGVDPIEAAAAV
AGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLT
ASIIGNVFSFKPLKAARLEDMRLPVAYVKTFRGPPTGIVVERERLDKFGKPLLGATTKPK
LGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYCMEAVNHASAVTGEVKG
HYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIVGWTAIQSISEWCRQNDMILHMHRAGH
GTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPPTVQGYYNVCREMKNEVDL
PRGLFFEQDWADLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGAT
ANRVALEAMVLARNEGRDIAHEGPEILRAAAKWCKPLEAALDIWGNISFNYTPTDTSDFV
PSVTAA

BLAST