GenomeNet

>smx:SM11_pD1413 cbbS; putative ribulose-1,5-bisphosphate carboxylase small subunit protein; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMEVEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR

BLAST