GenomeNet

>smx:SM11_pD1413 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS; putative ribulose-1,5-bisphosphate carboxylase small subunit protein (A)
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMEVEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR

BLAST