GenomeNet

>sna:Snas_2815 DNA polymerase LigD; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MAPVSQRVRFGDRELTVSHLDKLMYPETGTTKADVIDYYARAAAVLLPHITGRILTRVRY
PHGTGDVRFFEKHAPPAVPPWLRTATVPSKTHADGVTYVVADEPAALVWLANLYTIELHT
PQWQLDDTAPDSTRRPDRLVIDLDPGEGAGITECVHIAHLVRERLEADGLIAYPKTSGKN
GVHLVVPISGTQPAEQVIDYAKALARSLAAAHPRLVTATMGPRNRIGKVLIDWSQNNPAK
TTVAAYSLRGQPRPVISTPITWSELDAGNTGPFGPEAVLGRVATLGDLHADVTTPGPPLP
VAAGR

BLAST