GenomeNet

>snb:SP670_1923 type II restriction enzyme DpnII (EC:3.1.21.4); K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MKQTRNFDEWLSTMTDTVADWTYYTDFPKVYKNVSSIKVALNIMNSLIGSKNIQEDFLDL
YQNYPEILKVVPLLIAKRLRDTIIVKDPIKDFYFDFSKRNYSIEEYTMFLEKSGIFDLLQ
NHLVSNLVDYVTGVEVGMDTNGRKNRTGDAMENIVQSYLEAEGYILGENLFKEIEQNEIE
EIFSVDLSAITNDGNTVKRFDFVIKNEQVLYLIEVNFYSGSGSKLNETARSYKMIAEETK
AIPNVEFMWITDGQGWYKAKNNLRETFDILPFLYNINDLEHNILKNLK

BLAST