GenomeNet

>sng:SNE_A05230 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (EC:2.7.1.21) (A)
MAKLYFYYSAMNAGKSTTLLQSSYNYRERGMNTLLLAPRFDDRFGDPAIYSRIGLKQEAL
LFEKGTNIYYQTEEKIDEIGALHCVLIDEAHFLTKSQVAQLVSITKKLHVPVLCYGLRSD
FLGEPFEGSQYLLTWADELVEIKTICHCGSKATMNMRIDEEGSPVSKGNQVHIGGNESYL
SVCMKHFVEAIDAIEEIAFGKTHSNRS

BLAST