GenomeNet

>sng:SNE_A12840 no KO assigned | (GenBank) DNA polymerase LigD, polymerase domain-containing protein (A)
MSFKNQLAYILKQLQKLVLCNNKETLKYLANQACITPHIWLSRSDNLDCPDQMIFDLDPP
GNDFSLVLEAARDLREVLEKGCKLKTFVMTTGSKGLHVVVPIKPAHTFDEVRNYAKEIAA
FLVEQKMGKYTLNPRKTERGRKLFIDYLRNGYAQTSVASYAVRSLDGAPQSQCLLTGVR

BLAST