GenomeNet

>sno:Snov_3661 RuBisCO-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MPPLSRIEADYLIETAYDPRAAAEAMAGEQSSGTFVPVPGETPELKERSAARIEALEIVD
TVEAPSLPGAGHPKGEAPIRRARVTLSWPLDNLGPSLPNLMATVAGNLFELKQFSGLRLL
DIRLPHAFADAYGGPKFGVAGTRRLAGVEGRPLIGTIVKPSVGFGPQETADLVELLAEGG
IDFVKDDELQSDGPHCPFEERVRAVMRVVNDHADRTGRKVMFAFNITGELDQMRRRHDVV
LQHGGTCVMASLNSVGLVGMVELGRFTELPIHAHRNGWGYLSRAPMLGWSYVAWQKIWRL
AGADHMHVNGLSNKFSEADDSVIASARECLTPLFEDKPCIAMPVFSSGQSAKQAPGTYAA
LGSPDLIFAAGGGIMAHPDGPAAGVASLREAWEAAMASVPLADYARDHTALARALETYAV

BLAST