GenomeNet

>snt:SPT_1767 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) type II restriction enzyme (A)
MELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFENNRPVADFYCNHCS
EEFELKSKKGNFSSTINDGAYATMMKRVQADNNPNFFFLTYTKNFEVNNFLVLPKQFVTP
KSIIQRKPLAPTARRAGWIGCNIDLSQVPSKGRIFLVQDGQVRDPEKVTKEFKQGLFLRK
SSLSSRGWTIEILNCIDKIEGSEFTLEDMYRFESDLKNIFVKNNHIKEKIRQQLQILRDK
EIIEFKGRGKYRKL

BLAST