GenomeNet

>son:SO_3140 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tdk; thymidine kinase Tdk (A)
MAQLYFYYSAMNAGKSTSLLQSSYNYRERGMNTLVMTASIDDRYGKGKVASRIGIESDAQ
VFSSHDNLIEMITAAHQENHLSCVLVDECQFLSKEQVKQLTYIVDKIDIPVLCYGLRTDF
QGELFSGSHYLLAWADKLVELKTICHCGRKANMVVRLDGEGKVMREGEQVAIGGNESYES
VCRKHFREFIWD

BLAST