GenomeNet

>spc:Sputcn32_2506 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (EC:2.7.1.21) (A)
MAQLYFYYSSMNAGKSTSLLQSSYNYRERGMHTLVMTASIDDRYGKGKVASRIGIETDAQ
VFSSQDNLTEMIQAVHQVTPLSCVLLDECQFLSKEQVKQLTYVVDKLDIPVLCYGLRTDF
QGELFSGSHYLLAWADKLVELKTICHCGRKANMVVRLDDEGKVMREGEQVAIGGNERYES
VCRKHFREFIWD

BLAST