GenomeNet

>spd:SPD_1079 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) type II restriction endonuclease, putative (A)
MPVEIKTTKEIHPKIYAYTTPTVTSNEGWIKIGYTERDVTQRIKEQTHTAHIATDVLWTG
DAAYTEEPDKGKTFKDHDFHHFLSFHDVERRPKTEWFYFNGTPEKSKNLFDKFVQHDLSG
YQPGKGQDYTLRQEQEEAVAKTLAYFQEHAGGKFLWNAKPRFGKTLSTYDLARRMEAVNV
LIVTNRPAIANSWYDDFETFIAGQTTYKFVSESDSLKSRPILSRQEFLGILADDVRQLAF
ISLQDLKGSVYLGGEHDKLKWVTDLHWDLLVIDEAHEGVDTFKTDQAFNKIRRNFTLHLS
GTSFKALAKGDFTEEQIYNWSYADEQAAKYSWSLEQEEENPYESLPQLNLFTYQMSQMIG
EKLEKGAQIDGENIDYVFDLSEFFATDDKGKFIHEHDVRNWLDTLSSNEKYPFSTKELRN
ELKHTFWLLERVASAKALKALLEEHPIYENYEIVLAAGDGRMSEEDDKVKLKSLDLVRKA
IAENDKTITLSVGQLTTGVTIPEWTGVLMLSNLKSPALYMQAAFRAQNPYSWSDNKGNHF
RKERAYVFDFAPERTLILFDEFANNLSLVTAAGRGTSATREENIRELLNFFPIIAEDRAG
KMVEIDAKAVLTTPRQIKAREVLKRGFMSNLLFDNISGIFQASQTVLDILNELPVEKEGK
VQDSSDLLDFSDVTVDDEGNAVVDHEIVVNQQMRLFGEKVYGLGESVAELVTKDEERTQK
QLVNDLSKTVSSVIVEELKADYSLKTRETEQIKKQITATLENEIRKNDIERKISEAHIKQ
ELQQQLKEANDKAQKDKIQEDLEKRLEENKLIHKEKLEQTLKKEVEKMPEKFIEQVEIKR
VEQLKQSAQDEIRDHLRGFARTIPSFIMAYGDQTLTLDNFDAFVPEHVFYEVTGITIDQF
RYLRDGGQDFAGHLFDKATFDEAIQEFLRKKKELADYFKDQKEDIFDYIPPQKTNQIFTP
KRVVKRMVDDLEKENPGIFDDPSKTFIDLYMKSGLYIAELVKRLYNSNGLKEAFPNPEER
LKHILEKQVYGFAPSEIIYNISTNFIFGNLSKDISRKNFVLADTIPAAKEGSIQKLVDSY
FENN

BLAST