GenomeNet

>sph:MGAS10270_Spy0976 tdk2; Thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAI
PISNDMDIFTFIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPEI

BLAST