GenomeNet

>spn:SP_1850 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) dpnC; type II restriction endonuclease DpnI (A)
MELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFENNRPVADFYCNHCS
EEFELKSKKGNFSSTINDGAYATMMKRVQADNNPNFFFLTYTKNFEVNNFLVLPKQFVTP
KSIIQRKPLAPTARRAGWIGCNIDLSQVPSKGRIFLVQDGQVRDPEKVTKEFKQGLFLRK
SSLSSRGWTIEILNCIDKIEGSEFTLEDMYRFESDLKNIFVKNNHIKEKIRQQLQILRDK
EIIEFKGRGKYRKL

BLAST