GenomeNet

>spo:SPAC140.01 K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) sdh2; succinate dehydrogenase iron-sulfur subunit protein (EC:1.3.5.1) (A)
MFSRRIQVLSPFLKHFVNRNARMMATEANISATSANPQSQGENLKTFEIYRWNPEKPEVK
PKLQKYTVDLTKCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNINGSNTLACIC
NIKKDNKPTKIYPLPHCFIVKDLVPDLTYFYKQYKSIEPWLQNDNIPKDKEFYQSRADRA
KLDGLYECILCACCSTSCPSYWWNSEEYLGPAVLMQAYRWIIDSRDQATAKRLDVMQNSM
SVYRCHTIMNCARTCPKGLNPGLAIAKVKALMATA

BLAST