GenomeNet

>spq:SPAB_02748 K01785 aldose 1-epimerase [EC:5.1.3.3] | (GenBank) hypothetical protein (A)
MLNETPALAPDGQPYRLLTLRNSAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
HYPEQTSFLGASIGRYANRIANSRYTFAGETVQLSPSQGENQLHGGPEGFDKRRWQIVNQ
NDRQVLFALTSDDGDQGFPGHLCATAQYRLTDDNRISITYRATVDKPCPVNLTNHVYFNL
DGDRTDVRQHKLQILADEYLPVDESGIPRQGLKSVANTSFDFRMPKVIASEFLADDDQRK
VKGYDHAFLLQTQGDGKKPAARLWSQDGKLQMMVYTTAPALQFYSGNYLAGTPSRGPEPY
ADWQGLALESELLPDSPNHPEWPQPDCILRPGEEYASLTEYQFIPF

BLAST