GenomeNet

>spq:SPAB_04553 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MKLAAFALTLIPGIAIASSWTSPGFPTFSTQETGRFTSHAALTKGTRALTLHIDQQCWQP
SGAIKLNQMLSLKPCEGAPPQWRLFKDGDYTITVDTRSGTPTLLLSIKTEPKRTAQLAYQ
CPVWDGSPLTLDVRQTFPEGTVVRDYYSGQTDTVQNGQITLQPADSHGLLLLERAETHAS
APFNWRNATVYFVLTDRFRNGDPTNDHSYGRHKDGMQEIGTFHGGDLRGLTSQLDYLQQL
GVNALWISSPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALVDGAH
QRGIRILFDVVMNHAGYATLADMQEYQFGALYLSGAERQKILGDRWTNWRPATGQSWHSF
NDYINFSDSAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPAFY
ANKPGTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPAWQQLKTQASAAL
HEWKQANPDKALDDSPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMADKMQDFNVLSYLSSHDTRLFREGGDKAAELLLLSPGAVQIFYGDESARPFGP
TGSDPLQGTRSDMNWQDVSGKSAAAVAHWQRISQFRARHPAIGAGQQTTLTLKHGYGFVR
QYGDDTVMVVWAGRR

BLAST