GenomeNet

>spr:spr1101 K01155 type II restriction enzyme [EC:3.1.21.4] | (RefSeq) spnII-interrupted-C; type II restriction endonuclease (A)
MPVEIKTTKEIHPKIYAYTTPTVTSNEGWIKIGYTERDVTQRIKEQTHTAHIATDVLWTG
DAAYTEEPDKGKTFKDHDFHHFLSFHDVERRPKTEWFYFNGTPEKSKNLFDKFVQHDLSG
YQPGKGQDYTLRQEQEEAVAKTLAYFQEHAGGKFLWNAKPRFGKTLSTYDLARRMEAVNV
LIVTNRPAIANSWYDDFETFIAGQTTYKFVSESDSLKSRPILSRQEFLGILADDVRQLAF
ISLQDLKGSVYLGGEHDKLKWVTDLHWDLLVIDEAHEGVDTFKTDQAFNKIRRNFTLHLS
GTSFKALAKGDFTEEQIYNWSYADEQAAKYSWSLEQEEENPYESLPQLNLFTYQMSQMIG
EKLEKGAQIDGENIDYVFDLSEFFATDDKGKFIHEHDVRNWLDTLSSNEKYPFSTKELRN
ELKHTFWLLERVASAKALKALLEEHPIYENYEIVLAAGDGRMSEEDDKVKLKSLDLVRKA
IAENDKTITLSVGQLTTGVTIPEWTGVLMLSNLKSPALYMQAAFRAQNPYSWSDNKGNHF
RKERAYVFDFAPERTLILFDEFANNLSLVTAAGRGTSATREENIRELLNFFPIIAEDRAG
KMVEIDAKAVLTTPRQIKAREVLKRGFMSNLLFDNISGIFQASQTVLDILNELPVEKEGK
VQDSSDLLDFSDVTVDDEGNAVVDHEIVVNQQMRLFGEKVYGLGESVAELVTKDEERTQK
QLVNDLSKTVSSVIVEELKADYSLKTRETEQIKKQITATLENEIRKNDIERKISEAHIKQ
ELQQQLKEANDKAQKDKIQEDLEKRLEENKLIHKEKLEQTLKKEVEKMPEKFIEQVEIKR
VEQLKQSAQDEIRDHLRGFARTIPSFIMAYGDQTLTLDNFDAFVPEHVFYEVTGITIDQF
RYLRDGGQDFAGHLFDKATFDEAIQEFLRKKKELADYFKDQKEDIFDYIPPQKTNQIFTP
KRVVKRMVDDLEKENPGIFDDPSKTFIDLYMKSGLYIAELVKRLYNSNGLKEAFPNPEER
LKHILEKQVYGFAPSEIIYNISTNFIFGNLSKDISRKNFVLADTIPAAKEGSIQKLVDSY
FENN

BLAST