GenomeNet

>spr:spr1102 K01155 type II restriction enzyme [EC:3.1.21.4] | (RefSeq) spnII-interrupted-N; type II restriction endonuclease (A)
MLMTIDISEESLAKESADLLKILLKDRTTKKSIVWATHSYELLGKGFAPSDRINPSKVTG
NFANLIQPRSEKSKYEQKDRTKIRAEVFTPTWLVAKQNGYVESKLGSLSLEEYVDLRWLE
VTCGEAPYMVTRYDTVTGEEIPLSERVGFVDRKLQRISREVSDEVTFYKLVKDAYHASYG
YEYQGDSLLLARENLLATFEDYYLAKTGNQPTLEQKKEIATIISYNVFQMDGLKKSSPYS
AKQKQSQQLSLFADELEVQEVEESKTHIKDWKKNRMIGFERLSSEESEMKFDVVIGNPPY
QETGEARDEPIYHYFIDEAYKIADKSILITPARFLFKAGQTPKNWMEKMLEDKHLKVQFY
ELKSGKVFTGTDIKGGVAITYRDVDKDLGPIGVFTIFETLNGIVKKIEKHPEFETFSDLV
YPQGIYRFSNKLFSDYPNAEKLQGKGTKNKIVSKSLTQLDFVFKNNEEKDHVALLGRIGS
ERVYRYINKKYLDLPETFENYNVFVPEANGSGALGEVLSTPLIGEPLIGHTDTFLSIGNF
KTKFEADACIKFIKTKFARVLLGVLKVTQHNSRKTWYYVPLQDFTVNSDIDWTQSVTDID
RQLDQKYDLSPEEIAFIENHVREMD

BLAST