GenomeNet

>spu:583951 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase 2, mitochondrial-like (A)
MLTSHQTPHTHPFKMMERSIFSAKYCFVENLYKSGVMSEAEYAVLTEWFDWIITTSYCNV
DQIVYLRTSPEHCYERIQKRHRREETGISIDYLTKLHELYEDWLIHRNSWSLPAPVVVID
SNNSVEQMLQYYKDNKEHILPTGRDRCIVQR

BLAST