GenomeNet

>spu:583951 thymidine kinase 2, mitochondrial-like; K00857 thymidine kinase [EC:2.7.1.21] (A)
MSGHVTVALRRLVLSIHPLSMLSKSGRNLSPASTQRIDTRQRRMSSLSPLSFDKHSKLKE
NKKLTGLLYEDPFRWSFAFQTYVQLTMLTSHQTPHTHPFKMMERSIFSAKYCFVENLYKS
GVMSEAEYAVLTEWFDWIITTSYCNVDQIVYLRTSPEHCYERIQKRHRREETGISIDYLT
KLHELYEDWLIHRNSWSLPAPVVVIDSNNSVEQMLQYYKDNKEHILPTGRDRCIVQR

BLAST