GenomeNet

>spu:587972 K01229 lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62] | (RefSeq) lactase-like protein (A)
MKMLITLVSLIVFVNVGDVRSVDDPEFVFPDVFNDPERDAFLYGTFPDDFAWSSATSSYQ
IEGGWNADGKGESIWDTFTHEGGHVQNNDTGDVACDSYNKYQDDIDTMKDMGLNAYRFSI
SWPRVLPDGTIDNINEAGIKYYSDVIDALILAEITPMVTLYHWDLPQALMDDGGWDNETI
IDPFNDYANLCFDRFGDRVKLWITFNEPWVVTLLGYGTGEHAPGIKEIGTTVYTTSHNII
KAHAKAWHTYDDNWRPSQAGQIGITLNSNFVEPIDRDNASSVEAADRSLQFNLGWYAHPI
FINGDYPEVMKDRIGQKSMAQGLNESRLPEFTEAEKANIQGTSDFFGLNHYTSNYAWDLG
LNLNTDPSYWADSDVGGMQDDAWPTSASSWLRVVPWGIRRLLAWIKKEYGDLPVYVTENG
YSDEDVRELDDVMRQKYYTSYINEVLKAIEVDEVDVKGYTAWSLLDNFEWAEGYTERFGM
VYIDFSDEDRIRVPKISTEVYAEIVANHGFIKGMTTMPTTMMTTGMANAPKALSVFLTSF
ITLGAYILFR

BLAST