GenomeNet

>spu:589605 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) creatine kinase U-type, mitochondrial (A)
MASAVWQKLGPRGLAAIAAAATGIGIGMTYLSSPQRETQAAANCNLCEDGTYTPTFGQKS
NFPPSANFPDLSKHNNVMASHLTPGIYSRLSNLSTPNGFTLDECIQTGVDNPGHPFIKTV
GMVAGDEESYEVFKELMDPVIDERHNGYGPDDVHTTDLDSSKIRGGVLDSKYVLSSRVRT
GRSIRGLSLPPACNRAERRMVEQVVTDALAGLRGELAGQYYSLVTMSEEDQQKLIDDHFL
FDKPVSPLLTCAGMARDWPDARGIWHNNNKNFLVWINEEDHTRVISMEKGGNMKRVFDRF
CSGLNQVEESVKAKGWEFMWNEHLGYILSCPSNLGTGLRAGVHLKIPNLSKDISRLDNIL
EKLRLQKRGTGGVDSATVGDTFDISNNDRLGLSEVTLVQRVIDGVDLLIKMEKHLEKNRS
IEHLMPK

BLAST