GenomeNet

>spv:SPH_0865 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) superoxide dismutase [Mn] (General stress protein 24)(GSP24) (A)
MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK

BLAST