GenomeNet

>spv:SPH_0865 superoxide dismutase [Mn] (general stress protein 24)(GSP24) (EC:1.15.1.1); K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK

BLAST