GenomeNet

>spy:SPy_1140 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tdk2; thymidine kinase (EC:2.7.1.21) (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAI
PISNDMDIFTFIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPDI

BLAST