GenomeNet

>spz:M5005_Spy_0862 tdk2; thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAI
PISNDMDIFTFIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPDI

BLAST