GenomeNet

>sra:SerAS13_0161 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit (EC:1.1.5.3) (A)
MSSHSPDSETDVIVIGGGATGAGIARDCARRGLRCILLERHDIATGATGRNHGLLHSGAR
YAVTDGESARECIEENRILKRIAHHCIERTDGLFITLPQDSLAYQQQFIAACHSAGINAE
AIDPQLALRLEPAANPALIGAVRVPDGTVDPFRLTAANMLDAREHGAQILTYHQVVGLLR
VGDRVTGVRVFDHQTARRYDIYAEVVVNAAGIWGQQIAEYADLRIRMFPAKGALLILGHR
INNMVINRCRKPADADILVPGDTISLIGTTSTHIDYDQIDDMVVTPQEVDILIREGALLA
PELAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHASRDGLEGFITITGGKLMTYR
LMAQWATDKVCEKLGLDSPCTTAVEPLPGSRQTAEETVRSVVALPASIRGSAVYRHGDRA
SLVPAGNRLDNSLVCECEAVTAGEVRYAVNSLAVNNLVDLRRRTRVGMGTCQGELCACRA
AGLLTRFNVATPQQSIDQLSHFLNERWKGVRPIAWGDALRESEFTSWVYQGLCGLDAREK
QEADDAI

BLAST