GenomeNet

>srs:SerAS12_0217 fatty acid oxidation complex subunit alpha (EC:5.1.2.3); K01825 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8] (A)
MLYQGETLQLHWLDNGIAELVFNAPGSINKLDTRTVASLGEALDVLEKQTELKGLLVRSS
KAAFIVGADITEFLSLFAAPAEKLHQWLAFANATFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRVASPDARIGLPETKLGIMPGFGGSVRLPRLLGNDSALEIIAAGKDVSAKDALK
VGLVDAVVAPEKLVEAALKMLQQAIDGQLDWRAYRQPKLDPLKLSPIEAAMSFTTAKGMV
LQTAGKHYPAPMTAVKTIEAAAKLGRDEALKLETASFVPLARSNEARALVGIFLNDQFVK
SQAKKLAKNVEAPTQAAVLGAGIMGGGIAYQSALKGVPVIMKDISDKSLALGMNEAAKLL
NKQLERGKLDGLKMAQVLSTIQPTLDYAGIERAQVIVEAVVENPKIKAAVLSEVEGLIGE
DTVLASNTSTIPINHLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEQTSDNTIAAVVAY
ATRMGKTPIVVNDCPGFFVNRVLFPYFAGFSMLLRDGVDFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMGKDYRDAIDVMFDNQRFGQKNQLGFYRYSQDNKGKP
RKDNDEQTDALLAAVSQPRQTISDEEIIARMMIPMINEVVRCLEENIIASPAEADMALVY
GIGFPPFHGGAFRYLDTLGTANYVELAQRYTHLGALYQVPAGLRTKAERNESYYPVATPL
SDIATGQPA

BLAST