GenomeNet

>srs:SerAS12_2736 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDHRFGVGKVSSRIGLSSQAQ
LYNNDSILYAMIAQEHQQQPVHCVLLDESQFLTKAQVEQLCDVVDQLDIPVLCYGLRTDF
LGELFIGSQYLLAWADKLVELKTICHCGRKANMVLRLDESGQAMHAGEQVVIGGNESYVS
VCRKHYKEAIHALE

BLAST