GenomeNet

>srt:Srot_2335 DNA polymerase LigD, polymerase domain protein (A)
MASKREVEEIEADGVVVRLSNPDKRYFPKLGAGGSKRVLFEHYRKLAVGNGPIMRALRGR
PVNLQRFPEGIEGEAIYQKHAPKGKPDHVETARVLFPSGRGADSVVLHHPADVLWAVNLG
TVTFHPWPCHAPDTEHPDELRVDLDPQPGTSFEDARRVALDVPRPLLDELGLAGVPKTSG
GRGLHVLVPIRPRWEFAEVRRAGIALAQEVVRRADDRATFSWWKEERGERIFIDYNQNAR
DRTLAAPYAVRPTANATVSMPLTWAELETARPEDFTVANAAEHALGAPDPFAGRTPGSLD
KLLEQDTPLLPYPPQYPKMPDEPKRVQPSKDKGRKRG

BLAST