GenomeNet

>sru:SRU_1782 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (RefSeq) aldehyde dehydrogenase (NAD) family protein (A)
MPTGRRTTDCTLKFSAPRFGKALFPSKLSLFVSGMPDTFENYIGGRWTGAASQATFDNRN
PADPDDHIGDFPDSAPADVDAAVQAAQDAFSDWGSTPAPDRGKILKASGDLLAERKDEIA
RSMTREMGKPFFETKGDVQEAIDTAYYAASETRRLFGTTVPSELPDKMNMAIRRPLGVCG
IITAWNFPVAVPSWKIFPALAAGNTIVFKPSEDAPHSGLRFVQTLIDAGIPDGVINVVHG
ADEAGQALVEHPEVDAIGFTGSYEVGTAIAETCGRLNTPVSLEMGGKNPMIVMDDADLDL
ALEGAIWGAYGTTGQRCTATSRLICHESVHDELVAMIRDEAEALVLGDGNDADTDVGPLI
NQAAAETVHRYVEIGQEEGATLEMGGAPASVDGLDGHFYEPTLFTDVTPDMTIAQEEIFG
PVLATFEVGSYDEAVTVANDTQYGLSSSIYTQDVNKSFRAMRDLEAGITYVNGPTIGAEA
HMPFGGVKDTGNGQRDGGYAAFEFWTEHKTLYVDYSGQLQKAQMDSVED

BLAST