GenomeNet

>sru:SRU_2437 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (RefSeq) glpA; anaerobic glycerol-3-phosphate dehydrogenase subunit A (A)
MSNFCAHRTLPQFLHGPPPNMNDSPAVLVIGGGATGTGIARDLALRGVEVLLVEREGLSS
GASSRSHGLLHSGARYAEANRVGAEECIAENRVLRSIAGACIRDTGGLFVQLADDDPDYF
EEKRAACDAIGIETTLLSAAEARARVPGLSDDVERAMWVPDGVVYPSRLSAANAADAEAH
GGFVRPHAPLEDLVVERGQVVKALIGGTVDAAVEPTYVVNATGAWAGTVASMADVDLGMA
PSRGVMISVEYEGLGPALNRCRDPDDGDIVVPHDDEVVLGTTSVPVSDPDDYEEADWEVE
TSVRECATMLPPVADAPTVRTWWGVRPLYAPDEQASNRRGISRGFTTVDHAADGVDNFAS
IVGGKLTTYRQMAEAVSDHVCGELGVDAACETATRPLPGADDPDRLDEFVAAYDGQGPTD
ADVSGQG

BLAST