GenomeNet

>ssc:100153504 K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] | (RefSeq) F13A1; coagulation factor XIII A chain (A)
MAETPGTGAAFGGRRALPPNTSNAEENDPPTVELQGGLMPRGFNPQDYLNVTDVHLFKER
WDSNKVDHHTDKYDSKKLIVRRGQPFYIQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTY
IPVPIVSELQRGKWGAKVITTEDRSVRLSVQPSPDCIVGKFRMYVAVWTPYGVIRTSRNP
ETDTYILFNPWCEEDAVYLDNDKEREEYVLNDIGVIFYGEFNDIKSRSWSYGQFEEGILD
ACLYMMDRAKMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYSYGVPPSAWTGSV
DILLEYKSSQTPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNNANLQLDIFLEE
DGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQA
IKHGHVCFQFDAPFVFAEVNSDVIYITAKKDGTHVVKTLDTTHIGKLIVTKQVGADGMKD
ITDTYKFQEGQEEERLALETALMYGAKKPLSTEGIPKSRSDIHMDFEVERAVLGRDFKVV
LTFRNNSPTRYSVTAYLSGNITFYTGVSKGEFKNETFNVTLEPLSFKTEAVWVRAGEYMG
QLLEQAFLHFFVTARVNETNDVLAKQKSVVLTIPKISVKVRGTQAVGSDMVVTVEFTNPL
NEPLQNVWMRLDGPGVTRPLRKIFREIRPNATVQWEEVCRPWVSGPRKLMASMTSDSLRH
VYGELNLHIQRRPSV

BLAST