GenomeNet

>ssc:100154530 K05625 transglutaminase 2 [EC:2.3.2.13] | (RefSeq) TGM2; protein-glutamine gamma-glutamyltransferase 2 (A)
MAEDLILERCDLELEANGRDHHTADLCRERLVVRRGQAFRLTLHFEGRNYEPSVDRLTFS
AVTGPAPSEEAGTKARFRLSDAAEEGAWRAEVVDQQDNTLSLQLSTPASAPIGLYRLNLE
ASTGYEGSSFLLGHFTLLFNAWCPADDVYLDSDEERQEYVLTQQGFVYQGSAKFIKSIPW
NFGQFEDGILDSCLMLLDVNPKFMRDAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMFWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQSDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRRDDGSVYKSINRSL
VVGLKISTKSVGRDEREDITHTYKYPEGSPEEREAFTKANHLNKLADKEESEVAMRIRVG
EGMNMGSDFDVFAHITNNTAEEHTGRLLLCARTVSYNGVLGPECGTKDLLNFSLEPYSEK
SVPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEVSLRNPLTTPLSGCTFTVEGAGLTEEQKTVEIPDPVGAGEEVKVRVDLLPLLVG
RHKLVVNFNSNRLKAVKGFRNVIVGPS

BLAST