GenomeNet

>ssc:100155471 K05624 transglutaminase 6 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase 6 (A)
MKDKRVLAEAVISGEESDPAQAEEQLHPAVDSALGRSFGWSPSHIGHLRGAKQGNYWECP
KTCLVNVGLAGCSETPSGQSTHLGAEEARSWAALAWQKDTDAQRWKVCPNHPARKSETEP
FLDRGRAFPAHLAGWEKRGSRDDVKSSHAPWIRVTKVDWQRLRNGAAHHTQEYPCPELVV
RRGQKFTFTLELNKSLEYTETLIFTVETGPQASEALRTKAVFQTSELTVDDSWTAVKEAQ
TENATTVSLTSPPDAVIGRYQLSARVSSRRKHNDRKLGEFVLLFNPWCPEDDVFLASEEE
RQEYVLNDSGIIFRGVEKHIRAQGWNFGQFEEDILHICLSILDRSPSHQDDPATDVSRRH
DPIYVTRAVSAMVNSNNDRGVVQGQWKGKYGGGTSPLQWRGSVAILHKWFKGRFKPVKYG
QCWVFAGVMCTVLRCLGIATRIVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWWV
LGHWVPGAPRGQPRSGAQLC

BLAST