GenomeNet

>ssc:100155920 K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] | (RefSeq) ASH1L; histone-lysine N-methyltransferase ASH1L isoform X1 (A)
MDLRNTAMLGLGSDSEGFSRKSPSAISTSTLVSKREVELENNAKEEEDLRKWNRERNTEA
GKDDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTSIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKSGDAAAIECQSEESIHLHSQGENNPLSKKLSP
VHSEMTDYINAASSTLVGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTTAGLVSKDLIRKAGVSSVAGIIHKDLIKKPTISTAVGLVTKDPGKKPVFNAAVGLV
NKDSVKKLGTGTTTVFINKDLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVNKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVANSTMGLVNKDIGKKLVSCPMAGLVSKD
AINLKAEALLPTQEPLKASCSTNISSHESQELSESPKDSSTSKTFEKNVIRQSKESILEK
FSVRKEIINLEKEIFNEGTCIQADRGSYETSKHEKQPPVYCTSPDFQMGGASDASTAKSP
FSAVGESSLPSPSPTVSVNPLTRSPPETSSQMTPNPLLLSPTTELMKEISESVGKNQFTS
ESTHLNIGHRSVGHSMSIECKGIDKELNDSKSTHIDIPRISSSLGKKPSLTSESSIHTIT
PSVVNFTSLFSNKPFLKLGAVTAPDKHCQVAESLSTTLQSKPLKKRKGRKPRWTKMVARS
TCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPSSFVDHDFLKRRLPKLSKST
TPSLALLTDSEKPSHKSFATHKLPSSMCVSSDLLSDIYKPKRGRPKSKEMPQLEGPPKRT
LKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSPVKMKPP
VLSVAPFVATESPSKLESESDNHRSSSDFFESEDQFQDPDDLDDSHRPTVCSMSDLEMEP
DKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLA
ATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQATGSALG
PILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHSRQGSMI
QTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSDSGIGTD
NNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYLSYDKMK
RQKRKRKKKYPQLRNRQDPDFIADLEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNS
FYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYPSYGMPY
SPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYHKKKHKL
LRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQVSMDSGS
SRSVLESLKRYRFGKDTVGERYKHKEKHRCHMSCPHLSPSKSIINREEQWVHREPSESSP
LALGLQTPLQIDCSESSPSLSLGGFTPNSDPASSDEHTNLFTSAIGSCRVSNPNSSGRKK
LTDSPGLFSAQDTSLNRPHRKEPLPSSERAVQTLTGSQATSDKSSQRPSESTNCSPTRKR
SSSESTSSTVNGVPSRSPRLVASGDDSVDSLLQRMVHHEDQEPLEKNIDGVIASASVPPS
SSPGHSHNKDRTLGKPDSLLVPAVPSDSCSSSISLLSEKLPSSCSPHHIKRSVVEAMQRQ
ARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVVSMQA
FQAAQFVSPELNEGQEETALHLGPDTVTDVIEAVVQSVNLNPEHKKGLKRKSWLLEEQTK
KKQKPFPEEEEQENAKSFTEAAVEIPSPPETPAKLPEPESTLQPVLSLIPREKKAPRPPK
KKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLRQKRIDFQ
LPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVD
DCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFI
IEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEM
QKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRV
NGLTSNKSSQPVSTHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINTPTRLTPQLQMKP
MSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLYTRWNGICRDDGNIKSDV
FMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYKDSSRQSLAAPL
LNLPPKKKNADYYEKISDPLDLSTIEKQILIGYYKTVEAFDADMLKVFRNAEKYYGRKSP
VGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKDDDVIRCICG
LYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPHYTQPGCV
YFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRIEKLWKNE
KEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDLYTYCKGR
PKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDFSPHYVPD
NYKRNGGRSSWKSERSKPPLKDLGQDDDALPLIEEVLASQEQAANEMPSLVEPEREGATA
EVSESEKKTQESNQEPQAACTPEERRHNQRERLNQILLNLLEKIPGKNAIDVTYLLEEGS
GRKLRRRTLFIPENSFRK

BLAST