GenomeNet

>ssc:100158178 K05622 transglutaminase 5 [EC:2.3.2.13] | (RefSeq) TGM5; protein-glutamine gamma-glutamyltransferase 5 (A)
MAQGLEVALIDLQSSWNNVRHHTEEISSDRLLVRRGQAFIITLYFRNRAFQPGLDNIIFV
ADTGPLPDVAKGTRAVFSLAGHGGPSPWMASLEATGAASMEVSLCAPPMAAVGRYLLKVH
IESLQGPVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLAKSLNFQIDPATDCALRGSPVYISRVVCAMINSNDDNGVLNG
NWSENYLDGINPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNFHVWNECWMARRDLPEGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMSWLVFRGKEQKLHQDT
SSVGNFISTKGIQSNERDDITENYKYGEGSPQERQVFLKALQKLKAGGSQGSLREDLQPS
GSLPLRDSPRSLATPSLRPSDVVQVSLKFQLLDPPDMGRDIRFVLLALNMSLQFKDLRVN
LSAQSLLHDGSPLPPFWQDTAFLTLAPEEAKTHSCKIPYSQYSQYLSTDKLIRISALGEE
KNSPEKILVNKIITLAYPSIMINVLGAAIVNQPLSIQVIFSNPLSEPVADCVLTVEGSGL
FRKQQRVLIGVLKPQHRASLTLETVPFKSGQRQIQANLRSDKFKDIKGYKNIYVDLGL

BLAST