GenomeNet

>ssc:100515049 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) angiotensin-converting enzyme-like (A)
MIIHRTRERKARNVNIGGQVRRPRRDSCASRDPEMSFPSIRPSIHPSIHLPTHLHRDELY
SETVAKAFLQFYERTAQVVWNQFMEATWNYVTNITNKNREEMLRKDVERSQHTLYFGTRA
RLFKIDDFQDPDVKRMLSKLQNLYKAALPEDELREYNQILAYMETTYSMAQVCLNEGPCL
PLEPDLEEVMATSRDQKELLWAWQGWRDAVGRQLRMTFERYVQLSNKAAELNGYEDMGAM
WRSAYESDTLEQDVEQLYEELQPLYLNLHAYVRRGLYRFYGPQLIDPRGPIPAHILGNMW
AQSWVSILDLVLPFPEKPPEDITKIMKGQHWKPEKMFQEAEKFFTSLGLLSTPPEFWKNS
MMERPTDGREVECHASAWDFYNGEDFRIKKCTEVTIEDLLSIFHQMGHIQYFLQYKNLSV
IFRAGANPAFEEAVGSVITLSASSHKHLLNRGLLSHQHQDEGAGDQEDARRAARAWGCSW
GSPGRAEGRGPGSRLLTGPPCPEEEVNFLMSMALEKIAFIPFAYLVDRFRWKVFDGTIRK
AVYNQEWWNLRLKYQGLCPPVPRTEDDFDPGAKFHISASMPYIRYFLSLMLQFQIHEALC
KASGHVGPLHRCDIYNSKKAGKLLADVLKLGSSKPWPEVLQKITGETKVSTKALMTYFKP
LLNWLVTENVRHGEILGWPDFSCSLEQSFDKETDRAAFLGLELNPDQAKSGQWVLLALSF
VMLLMVLLLAYKVYTLEKKSLAQDTSAQDTSVQDTSTRDNSVHVPPPKAYFLGTAMEPHQ
VVRRQWMLLGLCLILMLCSVGLIIRIFTQHSWKPPWMRDEWWSWD

BLAST