GenomeNet

>ssc:100515581 K11418 histone deacetylase 11 [EC:3.5.1.98] | (RefSeq) HDAC11; histone deacetylase 11 isoform X1 (A)
MPHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVISFLKEEKLLTDSML
VEAREASDEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLKPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMGDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWATEDDEYLTKVER
NLEKALQEHRPDVVVYNAGTDVLEGDRLGGLSISPQGIVKRDELVFRMVRSLQVPILMVT
SGGYQKRTARIIADSILNLYGLGLIGPESASVSAQNSDSPLLPPEVP

BLAST