GenomeNet

>ssc:100519994 CKMT1, CKMT1B, Mia-CK, U-MtCK; creatine kinase U-type, mitochondrial (EC:2.7.3.2); K00933 creatine kinase [EC:2.7.3.2] (A)
MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPIRAASERRRQYPPSAEYPDLRKHN
NCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAE
LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGFFDERYVLSSRVRTGRSIRGLSLPPACT
RAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM
ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKKVFERFCRGLKEVERLIQER
GWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT
AATGSIFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPPPLPNKH

BLAST