GenomeNet

>ssc:100521870 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) OGDHL; LOW QUALITY PROTEIN: 2-oxoglutarate dehydrogenase-like, mitochondrial (A)
MNQVRLLPSRLGAQASRLLAPHGVQRFSWCSRSSGPPATFPSSRVGGGSSYMEEMYFAWL
ENPQSVHKSWDSFFRKASEEASYGLAQPRPPSVVPESRPAASGRTKTSKLVEDHLXVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTF
IGGSEHTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEXKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAATRWGSGDVKYHLGMYHERINRVTNRNITLSLVA
NPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSY
TTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAE
WRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTL
QEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPED
VLTHIGEVASSVPLEDFKIHTGLSRILRGREDMTRKRTVDWALAEYMAFGSLLKEGIHVR
LSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGY
AMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSS
ARPERFLQMSNDDSDAYPAFTQDFEVRQLYDCNWIVVNCSXPANYFHVLRRQILLPFRKP
LIIFTPKSLLRHPEAKSSFDQWYQGTSFQRVIPEDGAAVRAPEQVQRLIFCTGKVYYDLV
KERSNQGLDEQVAITRLEQISPFPFDLIKQEAEKYPGAELVWCQEEHKNMGYYDYISPRF
MTILGRARPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFDGKTF

BLAST