GenomeNet

>ssc:100523828 protein-glutamine gamma-glutamyltransferase 6-like (A)
MGPEFVPLASPEVLLLLLAWDHILRPLWGQFEEDILHICLSILDRSPSHQDDPATDVSRR
HDPIYVTRAVSAMVNSNNDRGVVQGQWKGKYGGGTSPLQWRGSVAILHKWFKGRFKPVKY
GQCWVFAGVMCTVLRCLGIATRIVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWN
FHVWNESWFARQDLGSSYNGWQVLDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFV
FAEVNADYITWLWNEDESRERVYSDTKKIGRCISTKAVGSDSRVDITSLYKYPEGSRKER
QVYSKAVKKLFGVDASGRRARVRRAGGRGLRCDELLKPATKPSIAGKFKVLEPPLLGHDL
RLALCLANLTSRSQRVHVNLSGATILYTRRPVAEILHESHAVKLGPEEGVM

BLAST